Gene Mb3032c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE OXIDOREDUCTASE |
| Comments | Mb3032c, -, len: 204 aa. Equivalent to Rv3007c,len: 204 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 204 aa overlap). Possible oxidoreductase (EC 1.-.-.-), similar to Q9EWU5|3SC5B7.04c PUTATIVE OXIDOREDUCTASE from Streptomyces coelicolor (162 aa), FASTA scores: opt: 376, E(): 1.5e-18, (41.35% identity in 150 aa overlap); Q9K416|SCG22.29c PUTATIVE FLAVIN-DEPENDENT REDUCTASE PROTEIN from Streptomyces coelicolor (169 aa), FASTA scores: opt: 246, E(): 1e-09,(34.1% identity in 135 aa overlap); and some similarity to coupling proteins of 4-hydroxyphenylacetic hydroxylase/monooxygenase e.g. Q9HWT6|HPAC|PA4092 Pseudomonas aeruginosa (170 aa), FASTA score: opt: 214; O68232|HPAC Photorhabdus luminescens (Xenorhabdus luminescens) (172 aa), FASTA score: opt: 198; Q9RPU2|HPAC Salmonella dublin (170 aa), FASTA score: opt: 197; etc. Equivalent to AAK47416 from Mycobacterium tuberculosis strain CDC1551 (236 aa) but shorter 32 aa. Start chosen by similarity. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3322451 | 3323065 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3032c|Mb3032c
MSEDVARIHDGDVIDESFDELMGMLDHPVFVVTTQADGHPAGCLVSFATQTSVQPPSFMVGLPRSTGTSEVASRSEHLAVHVLSQRQHVLAELFGSQTEEEVNKFARCSWRAGPCGMPILDDAAAWFIGRTASRSDVGDYVAYLLEPVSVWAPECSEDLLYLSDLDFDVDDIDPGKEASPRFYERERGDETRRYGVVRFTLDVP
Bibliography
No article yet recorded