Gene Rv3017c (TB12.9, ES6_8)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ESAT-6 like protein EsxQ (TB12.9) (ESAT-6 like protein 8) |
| Comments | Rv3017c, (MT3097, MTV012.31c), len: 120 aa. EsxQ, ESAT-6 like protein (see citation below), possibly secreted protein, very similar to AAK47433|MT3104 putative secreted ESAT-6 like protein 9 from Mycobacterium tuberculosis strain CDC1551 (96 aa), FASTA scores: opt: 315, E(): 1.2e-14, (65.7% identity in 70 aa overlap); Rv3019c|O53266|MTV012.33c putative secreted ESAT-6 like protein 9 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 315, E(): 1.2e-14, (65.7% identity in 70 aa overlap) and Rv0288|O53693|CFP7|MT0301|MTV035.16 10 KDA antigen CFP7 (low molecular weight protein antigen 7) (CFP-7) from Mycobacterium tuberculosis (95 aa), FASTA scores: opt: 303, E(): 7.4e-14, (66.2% identity in 68 aa overlap). An alternative start site exists at 3376801. Belongs to the ESAT6 family. Note previously known as TB12.9. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by proteomics (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3376490 | 3376852 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3017c|esxQ
VSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQAMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSFRGRWLDPRHAGPATAADAGD
Bibliography
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary
- Skjøt RL et al. [2002]. Epitope mapping of the immunodominant antigen TB10.4 and the two homologous proteins TB10.3 and TB12.9, which constitute a subfamily of the esat-6 gene family. Product
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
