Gene Mb3042c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | esat-6 like protein esxq (tb12.9) (esat-6 like protein 8) |
Comments | Mb3042c, esxQ, len: 120 aa. Equivalent to Rv3017c,len: 120 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 120 aa overlap). esxQ, putative ESAT-6 like protein 8, possibly secreted protein, very similar to AAK47433|MT3104 PUTATIVE SECRETED ESAT-6 LIKE PROTEIN 9 from Mycobacterium tuberculosis strain CDC1551 (96 aa),FASTA scores: opt: 315, E(): 1.2e-14, (65.7% identity in 70 aa overlap); Rv3019c|O53266|MTV012.33c PUTATIVE SECRETED ESAT-6 LIKE PROTEIN 9 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 315, E(): 1.2e-14, (65.7% identity in 70 aa overlap) and Rv0288|O53693|CFP7|MT0301|MTV035.16 10 KDA ANTIGEN CFP7 (LOW MOLECULAR WEIGHT PROTEIN ANTIGEN 7) (CFP-7) from Mycobacterium tuberculosis (95 aa), FASTA scores: opt: 303, E(): 7.4e-14, (66.2% identity in 68 aa overlap). BELONGS TO THE ESAT6 FAMILY. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3333105 | 3333467 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3042c|esxQ MSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQAMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSFRGRWLDPRHAGPATAADAGD
Bibliography
No article yet recorded