Gene Rv3019c (ES6_9, TB10.3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Secreted ESAT-6 like protein EsxR (TB10.3) (ESAT-6 like protein 9) |
| Comments | Rv3019c, (MT3104, MTV012.33c), len: 96 aa. EsxR, secreted ESAT-6 like protein (see citations below), most similar to O53693|AAK44525|Rv0288|CFP7|MT0301|MTV035.16 10 KDA antigen CFP7 (low molecular weight protein antigen 7) (CFP-7) from Mycobacterium tuberculosis (95 aa), FASTA scores: opt: 566, E(): 5.1e-31, (84.3% identity in 95 aa overlap). Also similar to Q9CD33|ML2531 possible cell surface protein from Mycobacterium leprae (96 aa), FASTA scores: opt: 472, E(): 8.3e-25, (66.6% identity in 96 aa overlap); O53264|Rv3017c|MTV012.31c putative secreted antigen from Mycobacterium tuberculosis (120 aa), FASTA scores: opt: 321, E(): 9.6e-15, (67.15% identity in 70 aa overlap); Q57165|AAK48357|O84901|X79562|ESAT6|Rv3875|MT3989|MTV027.10 esat6 gene from Mycobacterium tuberculosis strain Erdman (94 aa), FASTA scores: opt: 131, E(): 0.028, (26.1% identity in 88 aa overlap). Belongs to the ESAT6 family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by proteomics (see proteomics citations). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3378711 | 3379001 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3019c|esxR
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG
Bibliography
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Skjøt RL et al. [2002]. Epitope mapping of the immunodominant antigen TB10.4 and the two homologous proteins TB10.3 and TB12.9, which constitute a subfamily of the esat-6 gene family. Product
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
