Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductSecreted ESAT-6 like protein EsxR (TB10.3) (ESAT-6 like protein 9)
CommentsRv3019c, (MT3104, MTV012.33c), len: 96 aa. EsxR, secreted ESAT-6 like protein (see citations below), most similar to O53693|AAK44525|Rv0288|CFP7|MT0301|MTV035.16 10 KDA antigen CFP7 (low molecular weight protein antigen 7) (CFP-7) from Mycobacterium tuberculosis (95 aa), FASTA scores: opt: 566, E(): 5.1e-31, (84.3% identity in 95 aa overlap). Also similar to Q9CD33|ML2531 possible cell surface protein from Mycobacterium leprae (96 aa), FASTA scores: opt: 472, E(): 8.3e-25, (66.6% identity in 96 aa overlap); O53264|Rv3017c|MTV012.31c putative secreted antigen from Mycobacterium tuberculosis (120 aa), FASTA scores: opt: 321, E(): 9.6e-15, (67.15% identity in 70 aa overlap); Q57165|AAK48357|O84901|X79562|ESAT6|Rv3875|MT3989|MTV027.10 esat6 gene from Mycobacterium tuberculosis strain Erdman (94 aa), FASTA scores: opt: 131, E(): 0.028, (26.1% identity in 88 aa overlap). Belongs to the ESAT6 family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by proteomics (see proteomics citations).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33787113379001-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3019c|esxR
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG