Gene Mb3045c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | secreted esat-6 like protein esxr (tb10.3) (esat-6 like protein 9) |
| Comments | Mb3045c, esxR, len: 96 aa. Equivalent to Rv3019c,len: 96 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 96 aa overlap). esxR, putative secreted ESAT-6 like protein 9 (see citations below), most similar to O53693|AAK44525|Rv0288|CFP7|MT0301|MTV035.16 10 KDA ANTIGEN CFP7 (LOW MOLECULAR WEIGHT PROTEIN ANTIGEN 7) (CFP-7) from Mycobacterium tuberculosis (95 aa), FASTA scores: opt: 566, E(): 5.1e-31, (84.3% identity in 95 aa overlap). Also similar to Q9CD33|ML2531 POSSIBLE CELL SURFACE PROTEIN from Mycobacterium leprae (96 aa), FASTA scores: opt: 472, E(): 8.3e-25, (66.6% identity in 96 aa overlap); O53264|Rv3017c|MTV012.31c PUTATIVE SECRETED ANTIGEN from Mycobacterium tuberculosis (120 aa), FASTA scores: opt: 321, E(): 9.6e-15, (67.15% identity in 70 aa overlap); Q57165|AAK48357|O84901|X79562|ESAT6|Rv3875|MT3989|MTV027.1 0esat6 gene from Mycobacterium tuberculosis strain Erdman (94 aa), FASTA scores: opt: 131, E(): 0.028, (26.1% identity in 88 aa overlap). BELONGS TO THE ESAT6 FAMILY. TBparse score is 0.906. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3335270 | 3335560 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3045c|esxR
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG
Bibliography
No article yet recorded