Gene Rv3022c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PPE family protein PPE48 |
| Comments | Rv3022c, (MTV012.36c), len: 81 aa. PPE48, Member of M. tuberculosis PPE family with frameshift due to missing bp in codon 82. The ORF continues in downstream MTV012.35c. The sequence has been checked and no errors were detected. Identical to neigbouring ORF O53265|Rv3018c|MTV012.32c (434 aa), FASTA scores: opt: 526, E(): 6.2e-26, (100.0% identity in 81 aa overlap); and O69706|Rv739c|MTV025.087c (77 aa), FASTA scores: opt: 392, E(): 3.4e-18, (72.7% identity in 77 aa overlap). |
| Functional category | Pe/ppe |
| Regulon | Predicted to be in the Zur|Rv2359 regulon (See Maciag et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). <EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3380440 | 3380682 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3022c|PPE48
VTAPVWLASPPEVHSALLSAGPGPGSLQAAAAGWSALSAEYAAVAQELSVVVAAVGAGVWQGPSAELFVAAYVPYVAWLVQ
Bibliography
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
