Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAcetylation, substrate unknown
ProductGCN5-related N-acetyltransferase
CommentsRv3027c, (MTV012.42c), len: 281 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain in N-terminal part. See Vetting et al. 2005. Similar, to others e.g. Q9RCY9|SCM10.09c from Streptomyces coelicolor (256 aa), FASTA scores: opt: 498, E(): 7.8e-24, (47.7% identity in 237 aa overlap); BAB50158|MLR3216 from Rhizobium loti (291 aa), FASTA scores: opt: 359, E(): 3.7e-15, (33.35% identity in 246 aa overlap); etc. Start changed since first submission, extended by 25 aa.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33860743386919-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3027c|Rv3027c
MSIASVLIPSDKPHGVATGSSTGPRYSLLLSTDPSMVEAAQRLRYDVFSTTPGFALPAAADTRRDGDRFDEYCDHLLVRDDDTGELVGCYRMLAPAGAIAAGGLYTATEFDVCAFDPLRPSLVEMGRAVVREGHRNGGVVLLMWAGILAYLDRYGYDYVTGCVSVPIGGDGETPGSRLRGVRDFILNRHAAPPQCQVYPYRPVRVDGRSLDDILPPPRPAVPPLMRGYLRLGARACGEPAHDPDFGVGDFCLLLDKDHADTRYLRRLRSVAAASEMVNDAR