Gene Mb3053c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | gcn5-related n-acetyltransferase |
| Comments | Mb3053c, -, len: 246 aa. Equivalent to Rv3027c,len: 246 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 246 aa overlap). Conserved hypothetical protein, similar, but shorter 30 aa in N-terminus, to others e.g. Q9RCY9|SCM10.09c from Streptomyces coelicolor (256 aa), FASTA scores: opt: 498,E(): 7.8e-24, (47.7% identity in 237 aa overlap); BAB50158|MLR3216 from Rhizobium loti (291 aa), FASTA scores: opt: 359, E(): 3.7e-15, (33.35% identity in 246 aa overlap); etc. Equivalent to AAK47441 from Mycobacterium tuberculosis strain CDC1551 (281 aa) but shorter 35 aa. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3342634 | 3343374 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3053c|Mb3053c
MVEAAQRLRYDVFSTTPGFALPAAADTRRDGDRFDEYCDHLLVRDDDTGELVGCYRMLAPAGAIAAGGLYTATEFDVCAFDPLRPSLVEMGRAVVREGHRNGGVVLLMWAGILAYLDRYGYDYVTGCVSVPIGGDGETPGSRLRGVRDFILNRHAAPPQCQVYPYRPVRVDGRSLDDILPPPRPAVPPLMRGYLRLGARACGEPAHDPDFGVGDFCLLLDKDHADTRYLRRLRSVAAASEMVNDAR
Bibliography
No article yet recorded