Gene Rv3034c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; possibly involved in cellular metabolism. |
| Product | Possible transferase |
| Comments | Rv3034c, (MTV012.49c), len: 300 aa. Possible transferase (2.-.-.-), equivalent to AAK47449|MT3119 Hexapeptide transferase family protein from M. tuberculosis strain CDC1551 but N-terminus shorter 39 residues (262 aa), FASTA scores: opt: 1773, E(): 4.7e-105, (100.0% identity in 262 aa overlap). Similar to Q9CBR1|ML1719 from Mycobacterium leprae but also shorter in N-terminus (245 aa), FASTA scores: opt: 1549, E(): 6.6e-91, (90.6% identity in 244 aa overlap). Some weakly similarity with other transferases (C-terminal part shows some similarity to acetyltransferase from Methanococcus jannaschii (214 aa)). Alternative start possible at 3395077 but codon usage not as good. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3394019 | 3394921 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3034c|Rv3034c
VNVLSLGSSSGVVWGRVPITAPAGAATGVTSRADAHSQMRRYAQTGPTAKLSSAPMTTMWGAPLHRRWRGSRLRDPRQAKFLTLASLKWVLANRAYTPWYLVRYWRLLRFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIRAHEGSLRFGDKVVLGRDNVINTYLDIEIGDSVLMADWCYICDFDHRMDDITLPIKDQGIIKSPVRIGPDTWIGVKVSVLRGTTIGRGCVLGSHAVVRGAIPDYSIAVGAPAKVVKNRQLSWEASAAQRAELAAALADIERKKAAR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
