Gene Mb3060c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE TRANSFERASE |
| Comments | Mb3060c, -, len: 300 aa. Equivalent to Rv3034c,len: 300 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 300 aa overlap). Possible transferase (2.-.-.-), equivalent to AAK47449|MT3119 Hexapeptide transferase family protein from Mycobacterium tuberculosis strain CDC1551 but N-terminus shorter 39 residues (262 aa), FASTA scores: opt: 1773, E(): 4.7e-105, (100.0% identity in 262 aa overlap). Similar to Q9CBR1|ML1719 from Mycobacterium leprae but also shorter in N-terminus (245 aa), FASTA scores: opt: 1549, E(): 6.6e-91, (90.6% identity in 244 aa overlap). Some weakly similarity with other transferases (C-terminal part shows some similarity to acetyltransferase from Methanococcus jannaschii (214 aa)). Alternative start possible at 3395077 but codon usage not as good. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3350579 | 3351481 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3060c|Mb3060c
MNVLSLGSSSGVVWGRVPITAPAGAATGVTSRADAHSQMRRYAQTGPTAKLSSAPMTTMWGAPLHRRWRGSRLRDPRQAKFLTLASLKWVLANRAYTPWYLVRYWRLLRFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIRAHEGSLRFGDKVVLGRDNVINTYLDIEIGDSVLMADWCYICDFDHRMDDITLPIKDQGIIKSPVRIGPDTWIGVKVSVLRGTTIGRGCVLGSHAVVRGAIPDYSIAVGAPAKVVKNRQLSWEASAAQRAELAAALADIERKKAAR
Bibliography
No article yet recorded