Gene Rv3039c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O]. |
| Product | Probable enoyl-CoA hydratase EchA17 (crotonase) (unsatured acyl-CoA hydratase) (enoyl hydrase) |
| Comments | Rv3039c, (MTV012.54c), len: 254 aa. Probable echA17, Enoyl-CoA Hydratase/Isomerase Superfamily member (crotonase). Similar to many e.g. Q9L1E6|SC3D11.16 putative enoyl-CoA hydratase from Streptomyces coelicolor (255 aa), FASTA scores: opt: 625, E(): 1.5e-30, (45.55% identity in 224 aa overlap); O07137||ECH8_MYCLE|ML2402|MLCB1306.05c probable enoyl-CoA hydratase ECHA8 from Mycobacterium leprae (257 aa), FASTA scores: opt: 448, E(): 6.4e-20, (35.3% identity in 235 aa overlap), P97087|CRT crotonase / enoyl-CoA hydratase from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 420, E(): 3.1e-18, (31.2% identity in 234 aa overlap). Also similar to Mycobacterium tuberculosis AAK45356|O53418|Rv1070c|ECHA8|MT1100|MTV017.23c probable enoyl-CoA hydratase ECHA8 (257 aa), FASTA scores: opt: 450, E(): 4.9e-20, (36.4% identity in 226 aa overlap). Belongs to the enoyl-CoA hydratase/isomerase family. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3399419 | 3400183 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3039c|echA17
VPEFVNVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELRTLSAQEADTAARIRQQAVDAVAAIPKPTVAAITGYALGAGLTLALAADWRVSGDNVKFGATEILAGLIPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLIDDMVAPDDVYDAAAAWARRFLDGPPHALAAAKAGISDVYELAPAERIAAERRRYVEVFAAGQGGGSKGDRGGR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
