Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O].
ProductProbable enoyl-CoA hydratase EchA17 (crotonase) (unsatured acyl-CoA hydratase) (enoyl hydrase)
CommentsRv3039c, (MTV012.54c), len: 254 aa. Probable echA17, Enoyl-CoA Hydratase/Isomerase Superfamily member (crotonase). Similar to many e.g. Q9L1E6|SC3D11.16 putative enoyl-CoA hydratase from Streptomyces coelicolor (255 aa), FASTA scores: opt: 625, E(): 1.5e-30, (45.55% identity in 224 aa overlap); O07137||ECH8_MYCLE|ML2402|MLCB1306.05c probable enoyl-CoA hydratase ECHA8 from Mycobacterium leprae (257 aa), FASTA scores: opt: 448, E(): 6.4e-20, (35.3% identity in 235 aa overlap), P97087|CRT crotonase / enoyl-CoA hydratase from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 420, E(): 3.1e-18, (31.2% identity in 234 aa overlap). Also similar to Mycobacterium tuberculosis AAK45356|O53418|Rv1070c|ECHA8|MT1100|MTV017.23c probable enoyl-CoA hydratase ECHA8 (257 aa), FASTA scores: opt: 450, E(): 4.9e-20, (36.4% identity in 226 aa overlap). Belongs to the enoyl-CoA hydratase/isomerase family.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33994193400183-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3039c|echA17
VPEFVNVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELRTLSAQEADTAARIRQQAVDAVAAIPKPTVAAITGYALGAGLTLALAADWRVSGDNVKFGATEILAGLIPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLIDDMVAPDDVYDAAAAWARRFLDGPPHALAAAKAGISDVYELAPAERIAAERRRYVEVFAAGQGGGSKGDRGGR