Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionGenerates aldehyde or ketone from alcohol [catalytic activity: alcohol + NADP(+) = aldehyde or ketone + NADPH].
ProductProbable NADP-dependent alcohol dehydrogenase AdhC
CommentsRv3045, (MTV012.60), len: 346 aa. Probable adhC, NADP-dependent alcohol dehydrogenase, equivalent to Q9CBQ3|ADHA|ML1730 alcohol dehydrogenases from Mycobacterium leprae (362 aa), FASTA scores: opt: 1982, E(): 1.3e-111, (85.85% identity in 346 aa overlap); Q9AE96|ADHC from Mycobacterium smegmatis (348 aa), FASTA scores: opt: 1808, E(): 3.4e-101, (78.95% identity in 347 aa overlap); Q9EWF1|SCK13.33c putative dehydrogenase from Streptomyces coelicolor (346 aa), FASTA scores: opt: 1508, E(): 3.3e-83, (64.45% identity in 346 aa overlap); O06007|ADHA from Bacillus subtilis (349 aa), FASTA scores: opt: 1412, E(): 1.9e-77, (61.8% identity in 335 aa overlap); etc. Contains PS00059 Zinc-containing alcohol dehydrogenases signature. Belongs to the zinc-containing alcohol dehydrogenase family. High similarity with other bacterial ADH'S.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 3045 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark), and at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol, cell wall, and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34062853407325+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3045|adhC
MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIGKDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAIIGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDLILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQEMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL
      
Bibliography