Gene Rv3046c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3046c, (MTV012.61c), len: 124 aa. Conserved protein, similar to several hypothetical mycobacterial proteins e.g. Q50171|ML2258 U296W hypothetical protein from Mycobacterium leprae (100 aa), FASTA scores: opt: 194, E(): 7.6e-06, (35.9% identity in 103 aa overlap); and O06409|Rv0543c|MTCY25D10.22c from Mycobacterium tuberculosis (100 aa), FASTA scores: opt: 192, E(): 1e-05, (34.7% identity in 98 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3407314 | 3407688 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3046c|Rv3046c
VTKTFSHPHFFRSVLRWLQVGYPEGVPGPDRVALLSLLRSTPLTEEQIGEVVRHFTENGSPAVADRVIDRDEIAEFISEVTHHDAGPENIQRVAGILAAAGWPLAGVDVGESESGSDRAPASQG
Bibliography
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
