Gene Mb3072c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3072c, -, len: 124 aa. Equivalent to Rv3046c,len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 124 aa overlap). Conserved hypothetical protein, similar to several hypothetical mycobacterial proteins e.g. Q50171|ML2258 U296W HYPOTHETICAL PROTEIN from Mycobacterium leprae (100 aa),FASTA scores: opt: 194, E(): 7.6e-06, (35.9% identity in 103 aa overlap); and O06409|Rv0543c|MTCY25D10.22c from Mycobacterium tuberculosis (100 aa), FASTA scores: opt: 192, E(): 1e-05, (34.7% identity in 98 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3363874 | 3364248 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3072c|Mb3072c MTKTFSHPHFFRSVLRWLQVGYPEGVPGPDRVALLSLLRSTPLTEEQIGEVVRHFTENGSPAVADRVIDRDEIAEFISEVTHHDAGPENIQRVAGILAAAGWPLAGVDVGESESGSDRAPASQG
Bibliography
No article yet recorded