Gene Rv3053c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in electron transfer system for ribonucleotide reductase system NRDEF. |
| Product | Probable glutaredoxin electron transport component of NRDEF (glutaredoxin-like protein) NrdH |
| Comments | Rv3053c, (MTCY22D7.29), len: 79 aa. Probable nrdH, glutaredoxin-like protein, equivalent to Q9CBP8|NRDH|ML1736 from Mycobacterium leprae (80 aa), FASTA scores: opt: 478, E(): 2.7e-27, (91.15% identity in 79 aa overlap), and similar to many glutaredoxin-like proteins e.g. Q9XD65|NRDH from Corynebacterium glutamicum (Brevibacterium flavum) (77 aa), FASTA scores: opt: 382, E(): 1.5e-20, (72.35% identity in 76 aa overlap); and Q56108|NRDH_SALTY from Salmonella typhimurium (81 aa), FASTA scores: opt: 243, E(): 9.9e-11, (45.85% identity in 72 aa overlap). Belongs to the glutaredoxin family. |
| Functional category | Information pathways |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3414719 | 3414958 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3053c|nrdH
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
