Gene Mb3079c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE GLUTAREDOXIN ELECTRON TRANSPORT COMPONENT OF NRDEF (GLUTAREDOXIN-LIKE PROTEIN) NRDH |
| Comments | Mb3079c, nrdH, len: 79 aa. Equivalent to Rv3053c,len: 79 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 79 aa overlap). Probable nrdH,glutaredoxin-like protein, equivalent to Q9CBP8|NRDH|ML1736 from Mycobacterium leprae (80 aa),FASTA scores: opt: 478, E(): 2.7e-27, (91.15% identity in 79 aa overlap), and similar to many glutaredoxin-like proteins e.g. Q9XD65|NRDH from Corynebacterium glutamicum (Brevibacterium flavum) (77 aa), FASTA scores: opt: 382,E(): 1.5e-20, (72.35% identity in 76 aa overlap); and Q56108|NRDH_SALTY from Salmonella typhimurium (81 aa),FASTA scores: opt: 243, E(): 9.9e-11, (45.85% identity in 72 aa overlap). BELONGS TO THE GLUTAREDOXIN FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3371279 | 3371518 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3079c|nrdH
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA
Bibliography
No article yet recorded