Gene Rv3055
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (probably TetR-family) |
| Comments | Rv3055, (MTCY22D7.26c), len: 204 aa. Possible transcriptional regulatory protein, similar to Q9RD23|SCM1.20c putative TetR-family transcriptional regulator from Streptomyces coelicolor (234 aa), FASTA scores: opt: 471, E(): 4.6e-23, (44.9% identity in 187 aa overlap); and with low similarity to other e.g. Q9ADK8|2SCK31.12 putative TetR-family transcriptional regulator from Streptomyces coelicolor (198 aa), FASTA scores: opt: 208, 2.5e-06, (32.9% identity in 155 aa overlap); Q9ADD9|SCBAC20F6.11c putative TetR-family transcriptional from Streptomyces coelicolor (199 aa), FASTA scores: opt: 182, E(): 0.00012, (31.0% identity in 184 aa overlap). Contains potential helix-turn-helix motif from aa 48 to 69 (+3.42 SD). so may belong to the TetR/AcrR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3416081 | 3416695 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3055|Rv3055
VSGAERLGDLPVFARQEPVPERGDAARNRALLLEAARRLIARSGADAITMDDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERASQQAFLFGPPPLGPDAPPLDRLIAFGRERMRFVHAHHQLLSEANRDPQTRHSAALSVLRTHLRVLLASAPTTGDLDAQTDALLALLDVDYVEHQLNAGGHTLQTLGDAWESLARKLCGR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
