Gene Rv3064c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv3064c, (MTCY22D7.17), len: 141 aa. Probable conserved integral membrane protein, similar to many e.g. Q9KY40|SCC8A.08 putative integral membrane protein from Streptomyces coelicolor (153 aa), FASTA scores: opt: 391, E(): 2.4e-18, (48.45% identity in 130 aa overlap); Q9K461|SC2H12.23c putative integral membrane protein from Streptomyces coelicolor (151 aa), FASTA scores: opt: 339, E(): 5.1e-15, (46.7% identity in 124 aa overlap); BAB48975|MLR1652 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (130 aa), FASTA scores: opt: 319, E(): 8.7e-14, (41.45% identity in 123 aa overlap); Q9JR31|NMA2196|NMB0291 conserved hypothetical inner membrane protein from Neisseria meningitidis serogroup a and B (132 aa), FASTA scores: opt: 303, E(): 9.4e-13, (43.65% identity in 126 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3429825 | 3430250 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3064c|Rv3064c
MVKDLDRRLAGCLPAVLSLFRLVYGLLFAGYGSMILFGWPVTSAQPVEFGSWPGWYAGVIELVAGLLIATGLFTRAVAFVASGEMAVAYFWMHQPYALWPIGGPPDGNGGTPAILFCFGFFLLVFTGGGIYSIDARRTVTA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant