Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv3064c, (MTCY22D7.17), len: 141 aa. Probable conserved integral membrane protein, similar to many e.g. Q9KY40|SCC8A.08 putative integral membrane protein from Streptomyces coelicolor (153 aa), FASTA scores: opt: 391, E(): 2.4e-18, (48.45% identity in 130 aa overlap); Q9K461|SC2H12.23c putative integral membrane protein from Streptomyces coelicolor (151 aa), FASTA scores: opt: 339, E(): 5.1e-15, (46.7% identity in 124 aa overlap); BAB48975|MLR1652 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (130 aa), FASTA scores: opt: 319, E(): 8.7e-14, (41.45% identity in 123 aa overlap); Q9JR31|NMA2196|NMB0291 conserved hypothetical inner membrane protein from Neisseria meningitidis serogroup a and B (132 aa), FASTA scores: opt: 303, E(): 9.4e-13, (43.65% identity in 126 aa overlap); etc.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34298253430250-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3064c|Rv3064c
MVKDLDRRLAGCLPAVLSLFRLVYGLLFAGYGSMILFGWPVTSAQPVEFGSWPGWYAGVIELVAGLLIATGLFTRAVAFVASGEMAVAYFWMHQPYALWPIGGPPDGNGGTPAILFCFGFFLLVFTGGGIYSIDARRTVTA