Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3072c, (MTCY22D7.09), len: 174 aa. Hypothetical protein, similar in part to O87779 hypothetical 18.1 KDA protein (fragment) from Mycobacterium paratuberculosis (166 aa), FASTA scores: opt: 238, E(): 2.5e-08, (42.6% identity in 108 aa overlap); Q9AH10 putative F420-dependent dehydrogenase from Rhodococcus erythropolis (295 aa), FASTA scores: opt: 228, E(): 1.7e-07, (34.25% identity in 111 aa overlap); P71557|Y953_MYCTU|Rv0953c|MTCY10D7.21 possible oxidoreductase from Mycobacterium tuberculosis strain H37Rv (304 aa), FASTA scores: opt: 208, E(): 3.2e-06, (38.9% identity in 108 aa overlap); etc. N-terminal region similar to several proteins from Mycobacterium tuberculosis.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34357983436322-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3072c|Rv3072c
LACVRRSCDVTGTARAGIGAGADPAVVDAVAVAADDCGFATLWVGEHVVMVDRPASRYPYSRDGVIAVPAQADWLDPMIALSFAAAASSRVDVATGVLLLPEHNPVIVAKEAASLDRLSGRRLTLGVASDGPRRSSTRSECHSSGAQSAPPNTSLQCAHYGATTSHRSTATVGS