Gene Rv3072c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3072c, (MTCY22D7.09), len: 174 aa. Hypothetical protein, similar in part to O87779 hypothetical 18.1 KDA protein (fragment) from Mycobacterium paratuberculosis (166 aa), FASTA scores: opt: 238, E(): 2.5e-08, (42.6% identity in 108 aa overlap); Q9AH10 putative F420-dependent dehydrogenase from Rhodococcus erythropolis (295 aa), FASTA scores: opt: 228, E(): 1.7e-07, (34.25% identity in 111 aa overlap); P71557|Y953_MYCTU|Rv0953c|MTCY10D7.21 possible oxidoreductase from Mycobacterium tuberculosis strain H37Rv (304 aa), FASTA scores: opt: 208, E(): 3.2e-06, (38.9% identity in 108 aa overlap); etc. N-terminal region similar to several proteins from Mycobacterium tuberculosis. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3435798 | 3436322 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3072c|Rv3072c
LACVRRSCDVTGTARAGIGAGADPAVVDAVAVAADDCGFATLWVGEHVVMVDRPASRYPYSRDGVIAVPAQADWLDPMIALSFAAAASSRVDVATGVLLLPEHNPVIVAKEAASLDRLSGRRLTLGVASDGPRRSSTRSECHSSGAQSAPPNTSLQCAHYGATTSHRSTATVGS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
