Gene Rv3073c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Function unknown | 
| Product | Conserved hypothetical protein | 
| Comments | Rv3073c, (MTCY22D7.08), len: 118 aa. Conserved hypothetical protein, highly similar to other e.g. Q9F3D7|SC2H2.18 from Streptomyces coelicolor (119 aa), FASTA scores: opt: 399, E(): 2.5e-20, (53.05% identity in 115 aa overlap); Q9K4K9|SC5F8.15c from Streptomyces coelicolor (117 aa), FASTA scores: opt: 334, E(): 6e-16, (49.1% identity in 112 aa overlap); Q9HKD5|TA0666 from Thermoplasma acidophilum (134 aa), FASTA scores: opt: 334, E(): 6.7e-16, (42.35% identity in 111 aa overlap); BAB53507|MLL7394 from Rhizobium loti (Mesorhizobium loti) (120 aa), FASTA scores: opt: 309, E(): 3e-14, (43.65% identity in 110 aa overlap); etc. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3436329 | 3436685 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv3073c|Rv3073c
MVRETRVRVARVYEDIDPDDGQRVLVDRIWPHGIRKDDQRVGIWCKDVAPSKELREWYHHQPERFDEFASRYQEELHDSAALAELRKLTGRSVVTPVTATRHVARSHAAVLAQLLNGR
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant