Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3073c, (MTCY22D7.08), len: 118 aa. Conserved hypothetical protein, highly similar to other e.g. Q9F3D7|SC2H2.18 from Streptomyces coelicolor (119 aa), FASTA scores: opt: 399, E(): 2.5e-20, (53.05% identity in 115 aa overlap); Q9K4K9|SC5F8.15c from Streptomyces coelicolor (117 aa), FASTA scores: opt: 334, E(): 6e-16, (49.1% identity in 112 aa overlap); Q9HKD5|TA0666 from Thermoplasma acidophilum (134 aa), FASTA scores: opt: 334, E(): 6.7e-16, (42.35% identity in 111 aa overlap); BAB53507|MLL7394 from Rhizobium loti (Mesorhizobium loti) (120 aa), FASTA scores: opt: 309, E(): 3e-14, (43.65% identity in 110 aa overlap); etc.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34363293436685-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3073c|Rv3073c
MVRETRVRVARVYEDIDPDDGQRVLVDRIWPHGIRKDDQRVGIWCKDVAPSKELREWYHHQPERFDEFASRYQEELHDSAALAELRKLTGRSVVTPVTATRHVARSHAAVLAQLLNGR