Gene Rv3084
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; lipolytic enzyme involved in cellular metabolism. |
| Product | Probable acetyl-hydrolase/esterase LipR |
| Comments | Rv3084, (MTV013.05), len: 308 aa. Probable lipR, N-Acetyl-hydrolase/esterase, similar to other e.g. Q01109|BAH_STRH from Streptomyces hygroscopicus (299 aa), FASTA scores: opt: 558, E(): 4.1e-26, (40.25% identity in 246 aa overlap); Q9X8J4|SCE9.22 from Streptomyces coelicolor (266 aa), FASTA scores: opt: 544, E(): 2.5e-25, (36.95% identity in 257 aa overlap); Q56171|DEA from Streptomyces viridochromogenes (299 aa), FASTA scores: opt: 532, E(): 1.4e-24, (38.6% identity in 254 aa overlap); etc. Also similar to O06350|LIPF|Rv3487c|MTCY13E12.41c (277 aa), FASTA score: opt: 291, E(): 8.5e-10, (28.5% identity in 239 aa overlap). May belong to the 'GDXG' family of lipolytic enzymes. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Transcriptomics | mRNA identified by microarray analysis and real-time RT-PCR; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Operon | Rv3083, Rv3084, and Rv3085 are co-transcribed, by RT-PCR (See Singh et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3449997 | 3450923 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3084|lipR
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQGQPRGVVK
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Singh R et al. [2005]. Deciphering the genes involved in pathogenesis of Mycobacterium tuberculosis. Operon
- Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS and Kolattukudy PE [2006]. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. Product Transcriptome
- Kumar P et al. [2009]. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. Biochemistry
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant