Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; lipolytic enzyme involved in cellular metabolism.
ProductProbable acetyl-hydrolase/esterase LipR
CommentsRv3084, (MTV013.05), len: 308 aa. Probable lipR, N-Acetyl-hydrolase/esterase, similar to other e.g. Q01109|BAH_STRH from Streptomyces hygroscopicus (299 aa), FASTA scores: opt: 558, E(): 4.1e-26, (40.25% identity in 246 aa overlap); Q9X8J4|SCE9.22 from Streptomyces coelicolor (266 aa), FASTA scores: opt: 544, E(): 2.5e-25, (36.95% identity in 257 aa overlap); Q56171|DEA from Streptomyces viridochromogenes (299 aa), FASTA scores: opt: 532, E(): 1.4e-24, (38.6% identity in 254 aa overlap); etc. Also similar to O06350|LIPF|Rv3487c|MTCY13E12.41c (277 aa), FASTA score: opt: 291, E(): 8.5e-10, (28.5% identity in 239 aa overlap). May belong to the 'GDXG' family of lipolytic enzymes.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
TranscriptomicsmRNA identified by microarray analysis and real-time RT-PCR; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
OperonRv3083, Rv3084, and Rv3085 are co-transcribed, by RT-PCR (See Singh et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34499973450923+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3084|lipR
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQGQPRGVVK
      
Bibliography