Gene Mb3111
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE ACETYL-HYDROLASE/ESTERASE LIPR |
| Comments | Mb3111, lipR, len: 308 aa. Equivalent to Rv3084,len: 308 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 308 aa overlap). Probable lipR,N-Acetyl-hydrolase/esterase (EC 3.1.1.-), similar to other e.g. Q01109|BAH_STRH from Streptomyces hygroscopicus (299 aa), FASTA scores: opt: 558, E(): 4.1e-26, (40.25% identity in 246 aa overlap); Q9X8J4|SCE9.22 from Streptomyces coelicolor (266 aa), FASTA scores: opt: 544,E(): 2.5e-25, (36.95% identity in 257 aa overlap); Q56171|DEA from Streptomyces viridochromogenes (299 aa),FASTA scores: opt: 532, E(): 1.4e-24, (38.6% identity in 254 aa overlap); etc. Also similar to O06350|LIPF|Rv3487c|MTCY13E12.41c (277 aa), FASTA score: opt: 291, E(): 8.5e-10, (28.5% identity in 239 aa overlap). MAY BE BELONG TO THE 'GDXG' FAMILY OF LIPOLYTIC ENZYMES. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3406544 | 3407470 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3111|lipR
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQGQPRGVVK
Bibliography
No article yet recorded