Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; could be involved in cellular metabolism.
ProductHypothetical oxidoreductase
CommentsRv3093c, (MTCY164.04c), len: 334 aa. Hypothetical oxidoreductase, with some similarity with various oxidoreductases e.g. Q58929|mer|MJ1534 N5,N10-methylene tetrahydromethanopterin reductase from Methanococcus jannaschii (331 aa), FASTA scores: opt: 300, E(): 1.1e-10, (24.1% identity in 324 aa overlap); and Q9ZA30|GRA-ORF29 putative FMN-dependent monooxygenase from Streptomyces violaceoruber (343 aa), FASTA scores: opt: 264, E(): 1.5e-08, (30.45% identity in 335 aa overlap); Q9CCV8|ML0348 possible coenzyme F420-dependent oxidoreductase from Mycobacterium leprae (350 aa), FASTA scores: opt: 220, E(): 6.4e-06, (26.5% identity in 328 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34617603462764-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3093c|Rv3093c
MTDIEVALPFWLDRPDHEATDVALAAADTGFAALWIGEMATYDAFALATSIGLRTPNMTLKVGPLAVGVRGPVGLALGVSSVASLTGCRVDLALGASSPAIVAGWHGRPWAHHVPVMRETIECLRSIFTGARVEYSGRHVNSRGFRLRGAAPDTRIALGAFGPGMIRLAAQHADEVVLNLASPFRVGRVRAAIDSAAAAAGRAAPRLTVCVPVAVNPGAAAHSQLAAQLAVYLAPPGYGEMFSALGFDGLVRSARSRATRRELAVAVPSELLDRVCALGSPDRVAARLRAYADAGADCVAVVPATAEDPGGRVALRALRPGGLYGTAGDNDGRR