Gene Rv3093c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; could be involved in cellular metabolism. |
| Product | Hypothetical oxidoreductase |
| Comments | Rv3093c, (MTCY164.04c), len: 334 aa. Hypothetical oxidoreductase, with some similarity with various oxidoreductases e.g. Q58929|mer|MJ1534 N5,N10-methylene tetrahydromethanopterin reductase from Methanococcus jannaschii (331 aa), FASTA scores: opt: 300, E(): 1.1e-10, (24.1% identity in 324 aa overlap); and Q9ZA30|GRA-ORF29 putative FMN-dependent monooxygenase from Streptomyces violaceoruber (343 aa), FASTA scores: opt: 264, E(): 1.5e-08, (30.45% identity in 335 aa overlap); Q9CCV8|ML0348 possible coenzyme F420-dependent oxidoreductase from Mycobacterium leprae (350 aa), FASTA scores: opt: 220, E(): 6.4e-06, (26.5% identity in 328 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3461760 | 3462764 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3093c|Rv3093c
MTDIEVALPFWLDRPDHEATDVALAAADTGFAALWIGEMATYDAFALATSIGLRTPNMTLKVGPLAVGVRGPVGLALGVSSVASLTGCRVDLALGASSPAIVAGWHGRPWAHHVPVMRETIECLRSIFTGARVEYSGRHVNSRGFRLRGAAPDTRIALGAFGPGMIRLAAQHADEVVLNLASPFRVGRVRAAIDSAAAAAGRAAPRLTVCVPVAVNPGAAAHSQLAAQLAVYLAPPGYGEMFSALGFDGLVRSARSRATRRELAVAVPSELLDRVCALGSPDRVAARLRAYADAGADCVAVVPATAEDPGGRVALRALRPGGLYGTAGDNDGRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant