Gene Rv3095
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown. Could be involved in regulatory mechanism. |
| Product | Hypothetical transcriptional regulatory protein |
| Comments | Rv3095, (MTCY164.06), len: 158 aa. Possible regulatory protein, because contains possible helix-turn-helix motif at aa 39-61 (+4.83 SD). Similar to hypothetical proteins e.g. Q9I0C9|PA2713 from Pseudomonas aeruginosa (159 aa), FASTA scores: opt: 486, E(): 1.6e-25, (45.95% identity in 148 aa overlap); Q9AAF6|CC0645 from Caulobacter crescentus (188 aa), FASTA scores: opt: 479, E(): 5.3e-25, (45.75% identity in 153 aa overlap); Q9K408|2SCG61.07 from Streptomyces coelicolor (157 aa), FASTA scores: opt: 407, E(): 2.8e-20, (43.9% identity in 139 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3463973 | 3464449 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3095|Rv3095
MAVSDLSHRFEGESVGRALELVGERWTLLILREAFFGVRRFGQLARNLGIPRPTLSSRLRMLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQWGDEYLPRPEGPPIKLRHHTCGEHADPRLICTHCGEEITARNVTPEPGPGFKAKLASS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
