Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in growth. Thought to be involved in active transport of septation component across the membrane. Responsible for energy coupling to the transport system. Is coded in an operon essential for cell division.
ProductPutative cell division ATP-binding protein FtsE (septation component-transport ATP-binding protein ABC transporter)
CommentsRv3102c, (MTCY164.13_2c), len: 229 aa. Putative ftsE, cell division protein, septation component transport ATP-binding protein ABC transporter (see citations below), equivalent to O32883|FTSE|ML0669 cell division ATP-binding protein from Mycobacterium leprae (229 aa), FASTA scores: opt: 1384, E(): 2.4e-74, (91.7% identity in 229 aa overlap); and similar to Q9L1S6|FTSE from Streptomyces coelicolor (229 aa), FASTA scores: opt: 914, E(): 8.7e-47, (62.85% identity in 226 aa overlap); Q9A0S4|FTSE|SPY0644 from Streptococcus pyogenes (230 aa), FASTA scores: opt: 866, E(): 5.7e-44, (57.9% identity in 228 aa overlap); Q9CGX0|FTSE from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (230 aa), FASTA scores: opt: 792, E(): 1.3e-39, (52.2% identity in 228 aa overlap); etc. Other relatives from Mycobacterium tuberculosis include: MTCY253.24; MTCY16B7.10; MTCY9C4.04c; MTCY50.01; MTCY05A6.09c; MTCY04C12.31. Contains PS00017 ATP/GTP-binding site motif A (P-loop) and ABC transporters family signature (PS00211). Belongs to the ATP-binding transport protein family (ABC transporters).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34706803471369-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3102c|ftsE
MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR