Gene Rv3102c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in growth. Thought to be involved in active transport of septation component across the membrane. Responsible for energy coupling to the transport system. Is coded in an operon essential for cell division. |
| Product | Putative cell division ATP-binding protein FtsE (septation component-transport ATP-binding protein ABC transporter) |
| Comments | Rv3102c, (MTCY164.13_2c), len: 229 aa. Putative ftsE, cell division protein, septation component transport ATP-binding protein ABC transporter (see citations below), equivalent to O32883|FTSE|ML0669 cell division ATP-binding protein from Mycobacterium leprae (229 aa), FASTA scores: opt: 1384, E(): 2.4e-74, (91.7% identity in 229 aa overlap); and similar to Q9L1S6|FTSE from Streptomyces coelicolor (229 aa), FASTA scores: opt: 914, E(): 8.7e-47, (62.85% identity in 226 aa overlap); Q9A0S4|FTSE|SPY0644 from Streptococcus pyogenes (230 aa), FASTA scores: opt: 866, E(): 5.7e-44, (57.9% identity in 228 aa overlap); Q9CGX0|FTSE from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (230 aa), FASTA scores: opt: 792, E(): 1.3e-39, (52.2% identity in 228 aa overlap); etc. Other relatives from Mycobacterium tuberculosis include: MTCY253.24; MTCY16B7.10; MTCY9C4.04c; MTCY50.01; MTCY05A6.09c; MTCY04C12.31. Contains PS00017 ATP/GTP-binding site motif A (P-loop) and ABC transporters family signature (PS00211). Belongs to the ATP-binding transport protein family (ABC transporters). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3470680 | 3471369 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3102c|ftsE
MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR
Bibliography
- Tyagi JS et al. [1996]. An M. tuberculosis DNA fragment contains genes encoding cell division proteins ftsX and ftsE, a basic protein and homologues of PemK and small protein B. Transcriptome Regulation
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant