Gene Rv3103c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical proline-rich protein |
| Comments | Rv3103c, (MTCY164.13c), len: 145 aa. Hypothetical unknown pro-rich protein, with some similarity to Proline-rich proteins e.g. Q39789 proline-rich cell wall protein from Gossypium hirsutum (Upland cotton) (214 aa), FASTA scores: opt: 267, E(): 0.00014, (40% identity in 110 aa overlap). Equivalent to AAK47525 from M. tuberculosis strain CDC1551 (158 aa) but shorter 13 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3471413 | 3471850 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3103c|Rv3103c
VKLSNQKRHWPGYLFGRIRTSTLVLIAAFLAVWWIYETYRPQAPGPGDSPPTQVVPPGFVPDPDYTWVPRTRVQPPTVKATPTTTSSTPPVSPPETTTDSAVPPPFELPPPFGPGTTTPTPPAPLPQPGPGPTAGTYPKSEPPTR
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
