Gene Rv3117 (sseC3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May be a sulfotransferase involved in the formation of thiosulfate [catalytic activity: thiosulfate + cyanide = sulfite + thiocyanate]. |
| Product | Probable thiosulfate sulfurtransferase CysA3 (rhodanese-like protein) (thiosulfate cyanide transsulfurase) (thiosulfate thiotransferase) |
| Comments | Rv3117, (MTCY164.27, MT3199, O05793), len: 277 aa. Probable cysA3 (alternate gene name: sseC3), thiosulfate sulfurtransferase (see Wooff et al., 2002), equivalent to Q50036|CYSA|CYSA3|ML2198|THTR_MYCLE putative sulfurtransferase thiosulfate from Mycobacterium leprae (277 aa). Also highly similar to other putative thiosulfate sulfurtransferases e.g. P16385|THTR_SACER|CYSA from Saccharopolyspora erythraea (Streptomyces erythraeus) (281 aa), FASTA scores: opt: 1442, E(): 1.7e-84, (75.55% identity in 274 aa overlap); Q9RXT9DR0217|DR0217 from Deinococcus radiodurans (286 aa), FASTA scores: opt: 1046, E(): 2.6e-59, (53.8% identity in 275 aa overlap); Q9HMT7|TSSA|VNG2393G from Halobacterium sp. strain NRC-1 (293 aa), FASTA scores: opt: 1030, E(): 2.7e-58, (56.1% identity in 278 aa overlap); Q9Y8N8|APE2595 from Aeropyrum pernix (218 aa), FASTA scores: opt: 808, E(): 2.7e-44, (53.5% identity in 215 aa overlap); etc. Identical second copy present as Rv0815c|AL022004|MTV043.07c|MT0837|O05793|cysA2 (277 aa) (100.0% identity in 277 aa overlap). Also shows some similarity to P96888|THT2_MYCTU|SSEA|Rv3283|MT3382|MTCY71.23 putative thiosulfate sulfurtransferase from Mycobacterium tuberculosis (297 aa), FASTA scores: opt: 955, E(): 1.6e-53, (50.2% identity in 271 aa overlap); and Q59570|THT3_MYCTU|SSEB|Rv2291|MT2348|MTCY339.19c putative thiosulfate sulfurtransferase from Mycobacterium tuberculosis (284 aa), FASTA scores: E(): 1.4e-14, (26.7% identity in 292 aa overlap). Contains rhodanese active site and C-terminal signatures (PS00380, PS00683). Belongs to the rhodanese family. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Possibly identified in two-dimensional gel electrophoresis and by mass spectrometry in standing cultures (see Florczyk et al., 2001). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3483974 | 3484807 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3117|cysA3
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS
Bibliography
- Florczyk MA et al. [2001]. Identification and characterization of mycobacterial proteins differentially expressed under standing and shaking culture conditions, including Rv2623 from a novel class of putative ATP-binding proteins. Proteomics
- Wooff E et al. [2002]. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Homolog Mutant Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
