Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay be a sulfotransferase involved in the formation of thiosulfate [catalytic activity: thiosulfate + cyanide = sulfite + thiocyanate].
ProductProbable thiosulfate sulfurtransferase CysA3 (rhodanese-like protein) (thiosulfate cyanide transsulfurase) (thiosulfate thiotransferase)
CommentsRv3117, (MTCY164.27, MT3199, O05793), len: 277 aa. Probable cysA3 (alternate gene name: sseC3), thiosulfate sulfurtransferase (see Wooff et al., 2002), equivalent to Q50036|CYSA|CYSA3|ML2198|THTR_MYCLE putative sulfurtransferase thiosulfate from Mycobacterium leprae (277 aa). Also highly similar to other putative thiosulfate sulfurtransferases e.g. P16385|THTR_SACER|CYSA from Saccharopolyspora erythraea (Streptomyces erythraeus) (281 aa), FASTA scores: opt: 1442, E(): 1.7e-84, (75.55% identity in 274 aa overlap); Q9RXT9DR0217|DR0217 from Deinococcus radiodurans (286 aa), FASTA scores: opt: 1046, E(): 2.6e-59, (53.8% identity in 275 aa overlap); Q9HMT7|TSSA|VNG2393G from Halobacterium sp. strain NRC-1 (293 aa), FASTA scores: opt: 1030, E(): 2.7e-58, (56.1% identity in 278 aa overlap); Q9Y8N8|APE2595 from Aeropyrum pernix (218 aa), FASTA scores: opt: 808, E(): 2.7e-44, (53.5% identity in 215 aa overlap); etc. Identical second copy present as Rv0815c|AL022004|MTV043.07c|MT0837|O05793|cysA2 (277 aa) (100.0% identity in 277 aa overlap). Also shows some similarity to P96888|THT2_MYCTU|SSEA|Rv3283|MT3382|MTCY71.23 putative thiosulfate sulfurtransferase from Mycobacterium tuberculosis (297 aa), FASTA scores: opt: 955, E(): 1.6e-53, (50.2% identity in 271 aa overlap); and Q59570|THT3_MYCTU|SSEB|Rv2291|MT2348|MTCY339.19c putative thiosulfate sulfurtransferase from Mycobacterium tuberculosis (284 aa), FASTA scores: E(): 1.4e-14, (26.7% identity in 292 aa overlap). Contains rhodanese active site and C-terminal signatures (PS00380, PS00683). Belongs to the rhodanese family. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryIntermediary metabolism and respiration
ProteomicsPossibly identified in two-dimensional gel electrophoresis and by mass spectrometry in standing cultures (see Florczyk et al., 2001). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34839743484807+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3117|cysA3
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS