Gene Mb3144
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable cytochrome p450 141 cyp141 |
| Comments | Mb3144, cysA3, len: 320 aa. Equivalent to 5' end of Rv3117 and 3' end of Rv3121, len: 277 aa and 400 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 255 aa overlap and 56.7% identity in 150 aa overlap). Probable cysA3, thiosulfate sulfurtransferase (EC 2.8.1.1), equivalent to Q50036|CYSA|CYSA3|ML2198|THTR_MYCLE PUTATIVE SULFURTRANSFERASE THIOSULFATE from Mycobacterium leprae (277 aa). Also highly similar to other putative thiosulfate sulfurtransferases e.g. P16385|THTR_SACER|CYSA from Saccharopolyspora erythraea (Streptomyces erythraeus) (281 aa), FASTA scores: opt: 1442, E(): 1.7e-84, (75.55% identity in 274 aa overlap); Q9RXT9DR0217|DR0217 from Deinococcus radiodurans (286 aa), FASTA scores: opt: 1046,E(): 2.6e-59, (53.8% identity in 275 aa overlap); Q9HMT7|TSSA|VNG2393G from Halobacterium sp. strain NRC-1 (293 aa), FASTA scores: opt: 1030, E(): 2.7e-58, (56.1% identity in 278 aa overlap); Q9Y8N8|APE2595 from Aeropyrum pernix (218 aa), FASTA scores: opt: 808, E(): 2.7e-44,(53.5% identity in 215 aa overlap); etc. Identical second copy present as Rv0815c|AL022004|MTV043.07c|MT0837|O05793|cysA2 (277 aa) (100.0% identity in 277 aa overlap). Also shows some similarity to P96888|THT2_MYCTU|SSEA|Rv3283|MT3382|MTCY71.23 PUTATIVE THIOSULFATE SULFURTRANSFERASE from Mycobacterium tuberculosis (297 aa), FASTA scores: opt: 955, E(): 1.6e-53, (50.2% identity in 271 aa overlap); and Q59570|THT3_MYCTU|SSEB|Rv2291|MT2348|MTCY339.19c PUTATIVE THIOSULFATE SULFURTRANSFERASE from Mycobacterium tuberculosis (284 aa), FASTA scores: E(): 1.4e-14, (26.7% identity in 292 aa overlap). Contains rhodanese active site and C-terminal signatures (PS00380, PS00683). BELONGS TO THE RHODANESE FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large deletion of 2775 bp (RD12) leads to the loss of the COOH part of cysA3, the following CDSs, sseC1, moaE1, Rv3120 and a large part of cyp141 except the COOH end, compared to the homolog in Mycobacterium tuberculosis strain H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3440521 | 3441483 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3144|cyp141
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVNIAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT
Bibliography
No article yet recorded