Gene Rv3118 (sseC)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in sulphur metabolism. |
| Product | Conserved hypothetical protein SseC1 |
| Comments | Rv3118, (MTCY164.28, O05794), len: 100 aa. SseC1, conserved hypothetical protein, equivalent to Q9CBC7|ML2199 hypothetical protein from Mycobacterium leprae (100 aa), FASTA scores: opt: 545, E(): 3.1e-30, (84.0% identity in 10 aa overlap). Also similar to hypothetical proteins e.g. Q50035 from Saccharopolyspora erythraea (Streptomyces erythraeus) (101 aa), FASTA scores: opt: 345, E(): 9.7e-17, (57.15% identity in 98 aa overlap); and Q9K4H3|SCD66.02 from Streptomyces coelicolor (95 aa), FASTA scores: opt: 249, E(): 2.8e-10, (48.5% identity in 99 aa overlap). Some weak similarity with Q9ZB84|PCAG protocatechuate 3,4-dioxygenase alpha-subunit from Pseudomonas marginata (196 aa), FASTA scores: opt: 109, E(): 1.4, (31.3% identity in 83 aa overlap); and other bacterial proteins. Identical second copy present as Rv0814c|AL022004|MTV043.06c|SSEC2 from Mycobacterium tuberculosis (100 aa) (100.0% identity in 100 aa overlap). Note that previously known as sseC. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3484809 | 3485111 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3118|sseC1
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT
Bibliography
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant