Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3120, (MTCY164.30), len: 200 aa. Conserved hypothetical protein, with weak similarity to several hypothetical proteins and many N-methyl transferases e.g. Q9X9V1|ORF8 putative methyltransferase from Streptomyces coelicolor A3(2) (208 aa), FASTA scores: opt: 177, E(): 0.00011, (34.6% identity in 130 aa overlap); Q9XA90|SCF43A.25c putative methyltransferase from Streptomyces coelicolor (215 aa), FASTA scores: opt: 147, E(): 0.011, (31.3% identity in 166 aa overlap); BAB52127|MLL5735 probable methyltransferase from Rhizobium loti (Mesorhizobium loti) (247 aa), FASTA scores: opt: 133, E(): 0.11, (29.75% identity in 158 aa overlap). Highly similar to O53374|Rv3322c|MTV016.22c possible methyltransferase from Mycobacterium tuberculosis strain H37Rv (204 aa), FASTA scores: opt: 691, E(): 1.1e-38, (57.0% identity in 200 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34855723486174+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3120|Rv3120
MSPSPSALLADHPDRIRWNAKYECADPTEAVFAPISWLGDVLQFGVPEGPVLELACGRSGTALGLAAAGRCVTAIDVSDTALVQLELEATRRELADRLTLVHADLCSWQSGDGRFALVLCRLFWHPPTFRQACEAVAPGGVVAWEAWRRPIDVARDTRRAEWCLKPGQPESELPAGFTVIRVVDTDGSEPSRRIIAQRSL