Gene Rv3129
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3129, (MTCY164.40), len: 110 aa. Conserved hypothetical protein, with some similarity to various hypothetical proteins from Streptomyces coelicolor e.g. Q9RI34|SCJ12.26 hypothetical 14.5 KDA protein (137 aa), FASTA scores: opt: 141, E(): 0.0016, (39.3% identity in 84 aa overlap); Q9RI49|SCJ12.09c hypothetical 15.8 KDA protein (146 aa), FASTA scores: opt: 141, E(): 0.0017, (38.05% identity in 92 aa overlap); Q9RJ05|SCJ1.09C possible DNA-binding protein (233 aa), FASTA scores: opt: 140, E(): 0.0029, (34.85% identity in 89 aa overlap); Q9XA48|SCGD3.31c putative branched-chain alpha keto acid dehydrogenase E1 beta subunit (334 aa); etc. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3494660 | 3494992 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3129|Rv3129
VVQGRTVLFRTAEGAKLFSAVAKCAVAFEADDHNVAEGWSVIVKVRAQVLTTDAGVREAERAQLLPWTATLKRHCVRVIPWEITGRHFRFGPEPDRSQTFACEASSHNQR
Bibliography
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Park HD et al. [2003]. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Transcriptome
- Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR and Schoolnik GK [2003]. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. Regulon
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
