Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in lipid degradation [catalytic activity: NADPH + quinone = NADP(+) + semiquinone].
ProductProbable NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductase) (zeta-crystallin)
CommentsRv3141, (MTCY03A2.17c), len: 323 aa. Probable fadB4, quinone oxidoreductase, showing strong similarity to variety of quinone oxidoreductases and domains in polyketide and fatty acid synthases e.g. Q9HTV6|PA5234 probable oxidoreductase from Pseudomonas aeruginosa (325 aa), FASTA scores: opt: 737, E(): 1.4e-35, (39.65% identity in 328 aa overlap); Q9RYQ7|DRA0251 putative NADPH quinone oxidoreductase from Deinococcus radiodurans (336 aa), FASTA scores: opt: 688, E(): 1e-32, (40.6% identity in 325 aa overlap); Q9RVG8|DR1061 putative NADPH quinone oxidoreductase from Deinococcus radiodurans (388 aa), FASTA scores: opt: 559, E(): 3.3e-25, (36.3% identity in 325 aa overlap); BAB49685|MLL2594 probable quinone oxidoreductase from Rhizobium loti (Mesorhizobium loti) (326 aa), FASTA scores: opt: 519, E(): 5.9e-23, (34.25% identity in 330 aa overlap); Q9LXZ4|T5P19_110 quinone reductase-like protein from Arabidopsis thaliana (348 aa), FASTA scores: opt: 517, E(): 8.1e-23, (33.55% identity in 322 aa overlap); etc. Also similar to Q9AA38|CC0770 zinc-containing alcohol dehydrogenase from Caulobacter crescentus (325 aa), FASTA scores: opt: 673, E(): 7.2e-32, (40.2% identity in 326 aa overlap); and Q9ABX4|CC0096 zinc-containing alcohol dehydrogenase from Caulobacter crescentus (332 aa), FASTA scores: opt: 623, E(): 5.7e-29, (40.7% identity in 334 aa overlap). Also resembles Mycobacterium tuberculosis proteins P96826|Rv0149|MTCI5_23, MTCY13D12.11, MTCY24G1.03, MTCY19H9.01. Belongs to the zinc-containing alcohol dehydrogenase family, quinone oxidoreductase subfamily. Thought to be differentially expressed within host cells (see Triccas et al., 1999).
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35080953509066+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3141|fadB4
MRAVRVTRLEGPDAVEVAEVEEPTSAGVVIEVHAAGVAFPDALLTRGRYQYRPEPPFVLGAEIAGVVRSAPDNSQVRSGDRVVGLTMLTGGMAEVAVLSPERVFKLPDNMTFEAGAGVLFNDLTVYFALAVRGRLQAGETVLVHGAAGGIGTSTLRLAPALGASRTVAVVSTQEKAELATVAGATDVVLAEGFKDAVQELTNGRGVDIVVDPVGGDRFTDSLRSLAAGGRLLVIGFTGGEIPTVKVNRLLLNNIDVVGVGWGAWSLTHPDALAQQWSQLERLLRSGKLPPPEPVVYPLDQAAAAIASLENRTAKGKVVLRVRD