Gene Rv3141
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in lipid degradation [catalytic activity: NADPH + quinone = NADP(+) + semiquinone]. |
| Product | Probable NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductase) (zeta-crystallin) |
| Comments | Rv3141, (MTCY03A2.17c), len: 323 aa. Probable fadB4, quinone oxidoreductase, showing strong similarity to variety of quinone oxidoreductases and domains in polyketide and fatty acid synthases e.g. Q9HTV6|PA5234 probable oxidoreductase from Pseudomonas aeruginosa (325 aa), FASTA scores: opt: 737, E(): 1.4e-35, (39.65% identity in 328 aa overlap); Q9RYQ7|DRA0251 putative NADPH quinone oxidoreductase from Deinococcus radiodurans (336 aa), FASTA scores: opt: 688, E(): 1e-32, (40.6% identity in 325 aa overlap); Q9RVG8|DR1061 putative NADPH quinone oxidoreductase from Deinococcus radiodurans (388 aa), FASTA scores: opt: 559, E(): 3.3e-25, (36.3% identity in 325 aa overlap); BAB49685|MLL2594 probable quinone oxidoreductase from Rhizobium loti (Mesorhizobium loti) (326 aa), FASTA scores: opt: 519, E(): 5.9e-23, (34.25% identity in 330 aa overlap); Q9LXZ4|T5P19_110 quinone reductase-like protein from Arabidopsis thaliana (348 aa), FASTA scores: opt: 517, E(): 8.1e-23, (33.55% identity in 322 aa overlap); etc. Also similar to Q9AA38|CC0770 zinc-containing alcohol dehydrogenase from Caulobacter crescentus (325 aa), FASTA scores: opt: 673, E(): 7.2e-32, (40.2% identity in 326 aa overlap); and Q9ABX4|CC0096 zinc-containing alcohol dehydrogenase from Caulobacter crescentus (332 aa), FASTA scores: opt: 623, E(): 5.7e-29, (40.7% identity in 334 aa overlap). Also resembles Mycobacterium tuberculosis proteins P96826|Rv0149|MTCI5_23, MTCY13D12.11, MTCY24G1.03, MTCY19H9.01. Belongs to the zinc-containing alcohol dehydrogenase family, quinone oxidoreductase subfamily. Thought to be differentially expressed within host cells (see Triccas et al., 1999). |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3508095 | 3509066 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3141|fadB4
MRAVRVTRLEGPDAVEVAEVEEPTSAGVVIEVHAAGVAFPDALLTRGRYQYRPEPPFVLGAEIAGVVRSAPDNSQVRSGDRVVGLTMLTGGMAEVAVLSPERVFKLPDNMTFEAGAGVLFNDLTVYFALAVRGRLQAGETVLVHGAAGGIGTSTLRLAPALGASRTVAVVSTQEKAELATVAGATDVVLAEGFKDAVQELTNGRGVDIVVDPVGGDRFTDSLRSLAAGGRLLVIGFTGGEIPTVKVNRLLLNNIDVVGVGWGAWSLTHPDALAQQWSQLERLLRSGKLPPPEPVVYPLDQAAAAIASLENRTAKGKVVLRVRD
Bibliography
- Triccas JA et al. [1999]. Use of fluorescence induction and sucrose counterselection to identify Mycobacterium tuberculosis genes expressed within host cells. Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant