Gene Rv3143
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but could be involved in regulatory mechanism |
| Product | Probable response regulator |
| Comments | Rv3143, (MTCY03A2.15c), len: 133 aa. Probable response regulator, similar to other sensory transduction regulatory proteins e.g. Q9X810|SC6G10.25 from Streptomyces coelicolor (133 aa), FASTA scores: opt: 474, E(): 2.8e-24, (54.15% identity in 120 aa overlap); Q9KZ82|SCE25.04c from Streptomyces coelicolor (225 aa), FASTA scores: opt: 144, E(): 0.016, (32.3% identity in 127 aa overlap); Q9RZT4|DRB0029 from Deinococcus radiodurans (416 aa), FASTA scores: opt: 145, E(): 0.024, (30.65% identity in 124 aa overlap). Similar to other regulatory components of sensory transduction systems. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3509654 | 3510055 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3143|Rv3143
VPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVIRQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTWLASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
