Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, but could be involved in regulatory mechanism
ProductProbable response regulator
CommentsRv3143, (MTCY03A2.15c), len: 133 aa. Probable response regulator, similar to other sensory transduction regulatory proteins e.g. Q9X810|SC6G10.25 from Streptomyces coelicolor (133 aa), FASTA scores: opt: 474, E(): 2.8e-24, (54.15% identity in 120 aa overlap); Q9KZ82|SCE25.04c from Streptomyces coelicolor (225 aa), FASTA scores: opt: 144, E(): 0.016, (32.3% identity in 127 aa overlap); Q9RZT4|DRB0029 from Deinococcus radiodurans (416 aa), FASTA scores: opt: 145, E(): 0.024, (30.65% identity in 124 aa overlap). Similar to other regulatory components of sensory transduction systems.
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35096543510055+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3143|Rv3143
VPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVIRQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTWLASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH