Gene Rv3144c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PPE family protein PPE52 |
| Comments | Rv3144c, (MTCY03A2.14), len: 409 aa. PPE52, Member of the Mycobacterium tuberculosis PPE family, Gly-, Ala-rich, similar to others e.g. P71868|Rv3533c|MTCY03C7.23 (582 aa), FASTA scores: opt: 1007, E(): 5.2e-35, (56.2% identity in 306 aa overlap); and MTV014_3, MTCY6G11_5, MTCY98.0034c, MTCY31.06c, MTCY48.17, MTCY98.0029c, MTCY03C7.17c, etc. Nucleotide position 3510642 in the genome sequence has been corrected, T:C resulting in S226G. |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3510088 | 3511317 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3144c|PPE52
VSFVVLPPEINSLRMFIGAGTAPMLAAAAAWDGLAEELGTAAQSFASVTAGLAGQAWQGPAALAMAAAAAPYAGWLTAAAAQSAGAAGQARAVASIFEAAQAATVLPAAVAANRDAFVQLVMTNLFGQNAPLIAAAEGVYEEMWAADVAAMSGYYSGASAIAAQVVPWASLLQRFPGLGAGATGATGGESVGTGATGGESVGTGGGESVGTGGATASGGGVGYVGGGVASAGLAAGDPAHGSVGQGNFGGGDVGAGDVVASSATSAHAGVVSPGFIGAPLALAALGQMARGGTNSAPGTATESARAPEPAASAPPEAVVEVPELEVPAMGVLPTVDPKVAAKAAPLSTTRVGQSAGSGIPESTLRTAQGQQASETSAAEETAPSLRPEAAAGQLRPRVRKDPKIQMRGG
Bibliography
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
