Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol].
ProductProbable NADH dehydrogenase I (chain A) NuoA (NADH-ubiquinone oxidoreductase chain A)
CommentsRv3145, (MTCY03A2.13c), len: 128 aa. Probable nuoA, integral membrane NADH dehydrogenase, chain A, similar to others e.g. Q9XAQ4|NUOA from Streptomyces coelicolor (119 aa), FASTA scores: opt: 405, E(): 5.4e-20, (68.75% identity in 128 aa overlap); Q9RU86|DR1506 from Deinococcus radiodurans (160 aa), FASTA scores: opt: 327, E(): 9e-15, (40.3% identity in 124 aa overlap); BAB47039|NDHC from Triticum aestivum (Wheat), FASTA scores: opt: 273, E(): 2.6e-11, (38.1% identity in 126 aa overlap); etc. Also similar to a NADH-plastoquinone oxidoreductases e.g. P26303|NU3C_WHEAT|NDHC from Triticum aestivum (Wheat) (120 aa), FASTA scores: opt: 273, E(): 2.6e-1, (38.1% identity in 126 aa overlap). Belongs to the complex I subunit 3 family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis: transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002) and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35116823512068+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3145|nuoA
LNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGAASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVWRRGGLTWD