Gene Rv3149
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol]. |
| Product | Probable NADH dehydrogenase I (chain E) NuoE (NADH-ubiquinone oxidoreductase chain E) |
| Comments | Rv3149, (MTCY03A2.09c), len: 252 aa. Probable nuoE, NADH dehydrogenase, chain E, similar to others e.g. Q9XAQ8|NUOE from Streptomyces coelicolor (290 aa), FASTA scores: opt: 1002, E(): 5.7e-55, (69.5% identity in 213 aa overlap); P40915|NUHM_NEUCR|NUO-24 from Neurospora crassa (263 aa), FASTA scores: opt: 412, E(): 1.9e-18, (38055% identity in 192 aa overlap); P19234|NUHM_RAT from Rattus norvegicus (Rat) (241 aa), FASTA scores: opt: 410, E(): 2.4e-18, (23.9% identity in 237 aa overlap); etc. Belongs to the complex I 24 KDA subunit family. Binds a 2FE-2S cluster (potential). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3514657 | 3515415 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3149|nuoE
VTQPPGQPVFIRLGPPPDEPNQFVVEGAPRSYPPDVLARLEVDAKEIIGRYPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTMYRRRPTGEYLVGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYAPVVMVNWEFFDNQTPESARELVDSLRSDTPKAPTRGAPLCGFRQTSRILAGLPDQRPDEGQGGPGAPTLAGLQVARKNDMQAPPTPGADE
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
