Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol].
ProductProbable NADH dehydrogenase I (chain I) NuoI (NADH-ubiquinone oxidoreductase chain I)
CommentsRv3153, (MTCY03A2.05c), len: 211 aa. Probable nuoI, NADH dehydrogenase I, chain I, similar to others e.g. Q9XAR2|NUOI from Streptomyces coelicolor (211 aa), FASTA scores: opt: 825, E(): 9.3e-44, (70.1% identity in 164 aa overlap); Q56224|NQO9_THETH from Thermus aquaticus (subsp. thermophilus) (182 aa), FASTA scores: opt: 543, E(): 1.8e-26, (50.9% identity in 163 aa overlap); Q9RU95|DR1497 from Deinococcus radiodurans (178 aa), FASTA scores: opt: 527, E(): 1.7e-25, (48.75% identity in 162 aa overlap); etc. Contains two 4Fe-4S ferredoxins, iron-sulfur binding region signatures (PS00198). Belongs to the complex I 23 KDA subunit family. The iron-sulfur centers are similar to those of 'bacterial-type' 4FE-4S ferredoxins. Cofactor: binds two 4FE-4S clusters.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
OperonRv3152 and Rv3153 are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35205073521142+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3153|nuoI
VANTDRPALPHKRAVPPSRADSGPRRRRTKLLDAVAGFGVTLGSMFKKTVTEEYPERPGPVAARYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGCGLCIEACPTRALTMTYDYELADDNRADLIYEKDRLLAPLLPEMAAPPHPRTPGATDKDYYLGNVTAEGLRGVRESQTTGDSR