Gene Rv3154
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol]. |
| Product | Probable NADH dehydrogenase I (chain J) NuoJ (NADH-ubiquinone oxidoreductase chain J) |
| Comments | Rv3154, (MTCY03A2.04c), len: 262 aa. Probable nuoJ, transmembrane NADH dehydrogenase I, chain J, similar to others e.g. Q9XAR3|NUOJ from Streptomyces coelicolor (285 aa), FASTA scores: opt: 991, E(): 3.2e-52, (63.7% identity in 243 aa overlap); Q9JX90|NUOJ|NMA0006 from Neisseria meningitidis (serogroup A) (223 aa), FASTA scores: opt: 329, E(): 9.6e-13, (34.85% identity in 175 aa overlap); Q9K1B2|NMB0253 from Neisseria meningitidis (serogroup B) (223 aa), FASTA scores: opt: 326, E(): 1.5e-12, (34.85% identity in 175 aa overlap); etc. But also similarity with Q00243|NU6C_PLEBO|NDH6 NADH-plastoquinone oxidoreductase chain 6 homolog (catalytic activity: NADH + plastoquinone = NAD(+) + plastoquinol) from Plectonema boryanum (199 aa), FASTA scores: opt: 287, E(): 2.8e-10, (34.35% identity in 195 aa overlap). Similar to polypeptide 6 of the NADH-ubiquinol oxidoreductase of chloroplasts or mitochondria. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3521139 | 3521927 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3154|nuoJ
MTAVLASDVIVRTSTGEAVMFWVLSALALLGAVGVVLAVNAVYSAMFLAMTMIILAVFYMAQDALFLGVVQVVVYTGAVMMLFLFVLMLIGVDSAESLKETLRGQRVAAVLTGVGFGVLLISTIGQVATRGFAGLTVANANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQRELSQERFRPGGHPTPLPNPGVYARHNAVDVAALLPDGSYSELSVPRMLRTRGADGLQTPSPGAVSGSLEGGAS
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
