Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol].
ProductProbable NADH dehydrogenase I (chain J) NuoJ (NADH-ubiquinone oxidoreductase chain J)
CommentsRv3154, (MTCY03A2.04c), len: 262 aa. Probable nuoJ, transmembrane NADH dehydrogenase I, chain J, similar to others e.g. Q9XAR3|NUOJ from Streptomyces coelicolor (285 aa), FASTA scores: opt: 991, E(): 3.2e-52, (63.7% identity in 243 aa overlap); Q9JX90|NUOJ|NMA0006 from Neisseria meningitidis (serogroup A) (223 aa), FASTA scores: opt: 329, E(): 9.6e-13, (34.85% identity in 175 aa overlap); Q9K1B2|NMB0253 from Neisseria meningitidis (serogroup B) (223 aa), FASTA scores: opt: 326, E(): 1.5e-12, (34.85% identity in 175 aa overlap); etc. But also similarity with Q00243|NU6C_PLEBO|NDH6 NADH-plastoquinone oxidoreductase chain 6 homolog (catalytic activity: NADH + plastoquinone = NAD(+) + plastoquinol) from Plectonema boryanum (199 aa), FASTA scores: opt: 287, E(): 2.8e-10, (34.35% identity in 195 aa overlap). Similar to polypeptide 6 of the NADH-ubiquinol oxidoreductase of chloroplasts or mitochondria.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35211393521927+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3154|nuoJ
MTAVLASDVIVRTSTGEAVMFWVLSALALLGAVGVVLAVNAVYSAMFLAMTMIILAVFYMAQDALFLGVVQVVVYTGAVMMLFLFVLMLIGVDSAESLKETLRGQRVAAVLTGVGFGVLLISTIGQVATRGFAGLTVANANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQRELSQERFRPGGHPTPLPNPGVYARHNAVDVAALLPDGSYSELSVPRMLRTRGADGLQTPSPGAVSGSLEGGAS