Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol].
ProductProbable NADH dehydrogenase I (chain K) NuoK (NADH-ubiquinone oxidoreductase chain K)
CommentsRv3155, (MTCY03A2.03c), len: 99 aa. Probable nuoK, integral membrane NADH dehydrogenase I, chain K, similar to others e.g. Q9XAR4|NUOK from Streptomyces coelicolor (99 aa), FASTA scores: opt: 509, E(): 2.7e-31, (78.55% identity in 98 aa overlap); Q56226|NQOB_THETH|NQO11 from Thermus aquaticus (subsp. thermophilus) (95 aa), blast scores: initn: 298, init1: 180, bits: 85.7, FASTA scores: opt: 313, E(): 9.4e-17, (53.7% identity in 95 aa overlap); Q9RU97|DR1495 from Deinococcus radiodurans (103 aa), FASTA scores: opt: 309, E(): 2e-16, (52.0% identity in 100 aa overlap); etc. But also similarity with NADH-plastoquinone oxidoreductases chain 4L e.g. Q9MUL4|NULC_MESVI|NDHE from Mesostigma viride (catalytic activity: NADH + plastoquinone = NAD(+) + plastoquinol) (101 aa), FASTA scores: opt: 280, E(): 2.8e-14, (40.6% identity in 101 aa overlap); and P06261|NULC_TOBAC|NDHE|NDH4L from Nicotiana tabacum (Common tobacco) (101 aa), FASTA scores: opt: 259, E(): 1e-12, (43.0% identity in 93 aa overlap). Similar to polypeptide 4L of the NADH-ubiquinol oxidoreductase of chloroplasts or mitochondria.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35219243522223+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3155|nuoK
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMIAFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG