Gene Rv3161c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; involved in cellular metabolism. |
| Product | Possible dioxygenase |
| Comments | Rv3161c, (MTV014.05c), len: 382 aa. Possible dioxygenase, similar to subunit of several dioxygenases and related proteins e.g. BAB50510|MLR3662 dioxygenase, alpha subunit from Rhizobium loti (Mesorhizobium loti) (400 aa), FASTA scores: opt: 413, E(): 6.2e-20, (28.4% identity in 331 aa overlap); Q9A3T0|CC3122 rieske 2FE-2S family protein from Caulobacter crescentus (404 aa), FASTA scores: opt: 405, E(): 2.1e-19, (27.95% identity in 372 aa overlap); Q9HTF4|PA5410 probable ring hydroxylating dioxygenase, alpha-subunit from Pseudomonas aeruginosa (429 aa), FASTA scores: opt: 392, E(): 1.6e-18, (25.8% identity in 399 aa overlap); Q9AGK6|PHTAA phthalate dioxygenase large subunit from Arthrobacter keyseri (473 aa), FASTA scores: opt: 385, E(): 5.2e-18, (34.0% identity in 206 aa overlap); P76253|YEAW_ECOLI putative dioxygenase, alpha subunit from Escherichia coli (374 aa), FASTA scores: opt: 376, E(): 1.7e-17, (27.05% identity in 344 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3529990 | 3531138 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3161c|Rv3161c
MLSTDNRAELGDILTDIGDYLDDNPPALSLPPAAYTSSELWQLERERIFNRSWMLVAHVDQVAKTGDYVTVSVAGEPVMVVRDVDGQLHALSPICRHRLMLMVEPGAGRIDTLTCQYHLWRYGLDGRLRGAPHMAANLDFNRRECRLPQFAVATWNGLVWINLDADAEPIAAHLDLTDDEFAGYRLGEMVQVESWSHEWRANWKVAAENGHENYHVLGLHRQTLEPFVPGGGDLDVRQYSRWALRLRVPFTVPVEAKSLQLNEVQKSNLVVLWTFPNSALAIAGERVVWFGFIPQSIDRVQVLGGVLTTPELAADAAATAQTSQFVMAMINDEDRLGLEAVQVGAGSRFAERGHLSSKEWPGMLAFYRNLAMALVGDHPGAS
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant