Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; involved in cellular metabolism.
ProductPossible dioxygenase
CommentsRv3161c, (MTV014.05c), len: 382 aa. Possible dioxygenase, similar to subunit of several dioxygenases and related proteins e.g. BAB50510|MLR3662 dioxygenase, alpha subunit from Rhizobium loti (Mesorhizobium loti) (400 aa), FASTA scores: opt: 413, E(): 6.2e-20, (28.4% identity in 331 aa overlap); Q9A3T0|CC3122 rieske 2FE-2S family protein from Caulobacter crescentus (404 aa), FASTA scores: opt: 405, E(): 2.1e-19, (27.95% identity in 372 aa overlap); Q9HTF4|PA5410 probable ring hydroxylating dioxygenase, alpha-subunit from Pseudomonas aeruginosa (429 aa), FASTA scores: opt: 392, E(): 1.6e-18, (25.8% identity in 399 aa overlap); Q9AGK6|PHTAA phthalate dioxygenase large subunit from Arthrobacter keyseri (473 aa), FASTA scores: opt: 385, E(): 5.2e-18, (34.0% identity in 206 aa overlap); P76253|YEAW_ECOLI putative dioxygenase, alpha subunit from Escherichia coli (374 aa), FASTA scores: opt: 376, E(): 1.7e-17, (27.05% identity in 344 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35299903531138-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3161c|Rv3161c
MLSTDNRAELGDILTDIGDYLDDNPPALSLPPAAYTSSELWQLERERIFNRSWMLVAHVDQVAKTGDYVTVSVAGEPVMVVRDVDGQLHALSPICRHRLMLMVEPGAGRIDTLTCQYHLWRYGLDGRLRGAPHMAANLDFNRRECRLPQFAVATWNGLVWINLDADAEPIAAHLDLTDDEFAGYRLGEMVQVESWSHEWRANWKVAAENGHENYHVLGLHRQTLEPFVPGGGDLDVRQYSRWALRLRVPFTVPVEAKSLQLNEVQKSNLVVLWTFPNSALAIAGERVVWFGFIPQSIDRVQVLGGVLTTPELAADAAATAQTSQFVMAMINDEDRLGLEAVQVGAGSRFAERGHLSSKEWPGMLAFYRNLAMALVGDHPGAS