Gene Rv3162c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible integral membrane protein |
| Comments | Rv3162c, (MTV014.06c), len: 145 aa. Possible integral membrane protein, with some similarity to C-terminal part of Q10803|Rv2877c|MTCY274.08c hypothetical protein from Mycobacterium tuberculosis (287 aa), FASTA scores: opt: 112, E(): 6.9, (29.65% identity in 135 aa overlap); and other hypothetical proteins from other organisms. |
| Functional category | Cell wall and cell processes |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h and 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3531208 | 3531645 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3162c|Rv3162c
MTSFAHPGTRGLSTVFGLMMVGSAAVGSHGLAVVVGLAAVIAVGVAAVFRLAATLAVVLSVVMIVVSGPTHVLAALSGFCAAVYLVCRYGAGVVAGSWPTTVAAVGFTFAGLAATSFPLQVPWLPLAAPLAVLATYVLATRPFSR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
