Gene Rv3167c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein (probably TetR-family) |
| Comments | Rv3167c, (MTV014.11c), len: 208 aa. Probable transcriptional regulator, TetR family, similar to several transcriptional regulators e.g. Q9L2A4|SC8F4.22c (TetR/AcrR family) from Streptomyces coelicolor (234 aa), FASTA scores: opt: 317, E(): 7.5e-13, (33.35% identity in 210 aa overlap); Q9RK47|SCF12.11 (TetR/AcrR family) from Streptomyces coelicolor (206 aa), FASTA scores: opt: 293, E(): 2.1e-11, (32.65% identity in 199 aa overlap); Q54288 regulator of antibiotic transport complexes (TetR/AcrR family) (204 aa), FASTA scores: opt: 260, E(): 2.4e-09, (30.75% identity in 205 aa overlap); etc. Equivalent to AAK47595 from Mycobacterium tuberculosis strain CDC1551 but shorter 21 aa. Contains probable helix-turn-helix motif from aa 42 to 63 (Score 1727, +5.07 SD). May belong to the TetR/AcrR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3535431 | 3536057 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3167c|Rv3167c
MKADLPSLDKAPGAGRPRDPRIDSAILSATAELLVQIGYSNLSLAAVAERAGTTKSALYRRWSSKAELVHEAAFPAAPTALQAAAGDIAADIRMMIAATRDVFTTPVVRAALPGLVADMTADAELNARVLARFADLFAAVRMRLREAVDRGEAHPDVDPDRLIELIGGATMLRMLLYPDDMLDDAWVDQTTAIVVRGVHRAAPGGSVV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
