Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSupposedly involved in detoxification reactions.
ProductPossible peroxidase (non-haem peroxidase)
CommentsRv3177, (MTV014.21), len: 286 aa. Possible peroxidase (non-haem peroxidase), highly similar to Q9KJF9|W78 cultivar specificity protein (similar to alpha/beta hydrolase fold) W78 from Rhizobium leguminosarum (287 aa), FASTA scores: opt: 1059, E(): 2.3e-59, (61.4% identity in 272 aa overlap); BAB48728|MLL1328 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (286 aa), FASTA scores: opt: 746, E(): 1.1e-39, (43.25% identity in 282 aa overlap). Similar to nonheme chloroperoxidases and related esterases e.g. O73957|SAL lipolytic enzyme from Sulfolobus acidocaldarius (314 aa), FASTA scores: opt: 408, E(): 1.9e-18, (32.4% identity in 287 aa overlap); Q9AJM9|BIOH protein involved in biotin synthesis from Kurthia sp. 538-KA26 (267 aa), FASTA scores: opt: 324 ,E(): 3.2e-13, (30.0% identity in 250 aa overlap); Q9CBB1|ML2269 putative hydrolase (similar to alpha/beta hydrolase fold) from Mycobacterium leprae (265 aa); O05691|THCF_RHOER non-heme haloperoxidase from Rhodococcus erythropolis (similar to other bacterial non-heme BROMO- and chloro-peroxidases) (274 aa), FASTA scores: opt: 279, E(): 2.2e-10, (29.0% identity in 276 aa overlap); Q53540|est esterase (similar to alpha/beta hydrolase fold) from Pseudomonas putida (276 aa), FASTA scores: opt: 271, E(): 7.1e-10, (29.65% identity in 280 aa overlap); etc. Also similar to O06420|BPOC|Rv0554|MTCY25D10.33 hypothetical 28.3 KDA protein (similar to alpha/beta hydrolase fold) from M. tuberculosis (262 aa), FASTA scores: opt: 280 ,E(): 1.8e-10, (28.0% identity in 257 aa overlap). Equivalent to AAK47605 from Mycobacterium tuberculosis strain CDC1551 (300 aa) but shorter 14 aa. Similar to alpha/beta hydrolase fold. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35454473546307+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3177|Rv3177
VPQRQAGDIGATYQDAPTKSINVGGTRFVYRRLGADAGVPVIFLHHLGAVLDNWDPRVVDGIAAKHPVVTFDNRGVGASEGQTPDTVTTMADDAIAFVRALGFDQVDLLGFSLGGFVAQVIAQQEPQLVRKIILAGTGPAGGVGIGKVTFGTIRESIKATLTFRDPKELRFFTRTDSGKSAARQFVKRLKERKDNRDKSITVRAFRSQLKAIHAWGTQKPSDLTSIGHPVLIANGDDDTMVPTSNSLDLADRLPDATLRIYPDAGHGGIFQHHAQFVDDALQFLES