Gene Rv3177
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Supposedly involved in detoxification reactions. |
| Product | Possible peroxidase (non-haem peroxidase) |
| Comments | Rv3177, (MTV014.21), len: 286 aa. Possible peroxidase (non-haem peroxidase), highly similar to Q9KJF9|W78 cultivar specificity protein (similar to alpha/beta hydrolase fold) W78 from Rhizobium leguminosarum (287 aa), FASTA scores: opt: 1059, E(): 2.3e-59, (61.4% identity in 272 aa overlap); BAB48728|MLL1328 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (286 aa), FASTA scores: opt: 746, E(): 1.1e-39, (43.25% identity in 282 aa overlap). Similar to nonheme chloroperoxidases and related esterases e.g. O73957|SAL lipolytic enzyme from Sulfolobus acidocaldarius (314 aa), FASTA scores: opt: 408, E(): 1.9e-18, (32.4% identity in 287 aa overlap); Q9AJM9|BIOH protein involved in biotin synthesis from Kurthia sp. 538-KA26 (267 aa), FASTA scores: opt: 324 ,E(): 3.2e-13, (30.0% identity in 250 aa overlap); Q9CBB1|ML2269 putative hydrolase (similar to alpha/beta hydrolase fold) from Mycobacterium leprae (265 aa); O05691|THCF_RHOER non-heme haloperoxidase from Rhodococcus erythropolis (similar to other bacterial non-heme BROMO- and chloro-peroxidases) (274 aa), FASTA scores: opt: 279, E(): 2.2e-10, (29.0% identity in 276 aa overlap); Q53540|est esterase (similar to alpha/beta hydrolase fold) from Pseudomonas putida (276 aa), FASTA scores: opt: 271, E(): 7.1e-10, (29.65% identity in 280 aa overlap); etc. Also similar to O06420|BPOC|Rv0554|MTCY25D10.33 hypothetical 28.3 KDA protein (similar to alpha/beta hydrolase fold) from M. tuberculosis (262 aa), FASTA scores: opt: 280 ,E(): 1.8e-10, (28.0% identity in 257 aa overlap). Equivalent to AAK47605 from Mycobacterium tuberculosis strain CDC1551 (300 aa) but shorter 14 aa. Similar to alpha/beta hydrolase fold. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3545447 | 3546307 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3177|Rv3177
VPQRQAGDIGATYQDAPTKSINVGGTRFVYRRLGADAGVPVIFLHHLGAVLDNWDPRVVDGIAAKHPVVTFDNRGVGASEGQTPDTVTTMADDAIAFVRALGFDQVDLLGFSLGGFVAQVIAQQEPQLVRKIILAGTGPAGGVGIGKVTFGTIRESIKATLTFRDPKELRFFTRTDSGKSAARQFVKRLKERKDNRDKSITVRAFRSQLKAIHAWGTQKPSDLTSIGHPVLIANGDDDTMVPTSNSLDLADRLPDATLRIYPDAGHGGIFQHHAQFVDDALQFLES
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant