Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3188, (MTV014.32), len: 115 aa. Conserved hypothetical protein, with similarity to other proteins from Mycobacterium tuberculosis: Q10868|YJ90_MYCTU|Rv1990c|MT2044|MTCY39.29 hypothetical protein (113 aa), FASTA scores: opt: 184, E(): 8.1e-06, (28.45% identity in 109 aa overlap); and O06299|Rv0348|MTCY13E10.08 hypothetical protein (217 aa), FASTA scores: opt: 129, E(): 0.074, (30.0% identity in 100 aa overlap). Also some similarity with C-terminus of Q9XA59|SCGD3.19 putative two-component system response transcriptional regulator from Streptomyces coelicolor (218 aa), FASTA scores: opt: 114, E(): 0.76, (30.0% identity in 110 aa overlap) (for this one, no similarity exists in the N-terminal region with the N-terminus of other regulatory components of sensory transduction systems). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35542983554645+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3188|Rv3188
MAVTLDRAVEASEIVDALKPFGVTQVDVAAVIQVSDRAVRGWRTGDIRPERYDRLAQLRDLVLLLSDSLTPRGVGQWLHAKNRLLDGQRPVDLLAKDRYEDVRSAAESFIDGAYV