Gene Rv3192
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical alanine and proline-rich protein |
| Comments | Rv3192, (MTV014.36), len: 153 aa. Conserved hypothetical ala- and pro-rich protein, with weak similarity to N-terminal half of several proteins e.g. Q11030|YD60_MYCTU|Rv1360|MT1405|MTCY02B10.24 hypothetical 37.3 KDA protein from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 245, E(): 3.7e-08, (33.1% identity in 157 aa overlap); O30260|AF2411 conserved hypothetical protein from Archaeoglobus fulgidus (363 aa), FASTA scores: opt: 144, E(): 0.072, (32.6% identity in 92 aa overlap); Q9ZA30|GRA-ORF29 putative FMN-dependent monooxygenase from Streptomyces violaceoruber (343 aa), FASTA scores: opt: 133, E(): 0.33, (25.15% identity in 159 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3559563 | 3560024 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3192|Rv3192
MIPQPLSQLGDLARRPGRRVLCSPKTAAPSISNATVASPAAPGLELSTGIALAFPRGPFVPAAAAWELQEATSGKFQLGLGTQVRKNVVHRYGMAFHRPGPRLRYLLAVKACFAVFQTGTPDHHGEFDNPDFITAQWSPARIDPPGPSPAGPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
