Gene Rv3203
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; presumed lipolytic enzyme involved in cellular metabolism. |
| Product | Possible lipase LipV |
| Comments | Rv3203, (MTCY07D11.23c), len: 224 aa. Possible lipV, hydrolase lipase, showing some similarity to other lipases e.g. Q9JSN0|NMA2216 putative hydrolase from Neisseria meningitidis (serogroup A) (312 aa), FASTA scores: opt: 192, E(): 0.00016, (45.2% identity in 73 aa overlap); Q9RK95|SCF1.09 putative hydrolase from Streptomyces coelicolor (258 aa), FASTA scores: opt: 188, E(): 0.00024, (30.1% identity in 226 aa overlap); Q9KZC3|SC6F7.19c putative lipase from Streptomyces coelicolor (269 aa), FASTA scores: opt: 179, E(): 0.00086, (36.35% identity in 121 aa overlap); etc. Equivalent to AAK47641 Hydrolase, alpha/beta hydrolase family from Mycobacterium tuberculosis strain CDC1551 (261 aa) but shorter 37 aa. Contains serine active site signature of lipases (PS00120). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3580638 | 3581312 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3203|lipV
LPEIPIAAPDLLGHGRSPWAAPWTIDANVSALAALLDNQGDGPVVVVGHSFGGAVAMHLAAARPDQVAALVLLDPAVALDGSRVREVVDAMLASPDYLDPAEARAEKATGAWADVDPPVLDAELDEHLVALPNGRYGWRISLPAMVCYWSELARDIVLPPVGTATTLVRAVRASPAYVSDQLLAALDKRLGADFELLDFDCGHMVPQAKPTEVAAVIRSRLGPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS and Kolattukudy PE [2006]. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. Product Transcriptome
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
