Gene Rv3204
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Causes methylation |
| Product | Possible DNA-methyltransferase (modification methylase) |
| Comments | Rv3204, (MTCY07D11.22c), len: 101 aa. Possible DNA methyltransferase, similar to many hypothetical bacteriel proteins and methyltransferases e.g. Q9KT40|VC1065 methylated-DNA--protein-cysteine methyltransferase-related protein from Vibrio cholerae (100 aa), FASTA scores: opt: 170, E(): 2.8e-05, (34.35% identity in 99 aa overlap); Q9UTN9|SPAC1250.04c putative methyltransferase from Schizosaccharomyces pombe (Fission yeast) (108 aa), FASTA scores: opt: 161, E(): 0.00013, (36.65% identity in 101 aa overlap); Q9YDF4|APE0959 175 AA long hypothetical methylated-DNA--protein-cysteine methyltransferase from Aeropyrum pernix (175 aa), FASTA scores: opt: 144, E(): 0.003, (37.95% identity in 87 aa overlap); Q50855 putative methylguanine-DNA methyltransferase from Myxococcus xanthus (147 aa), FASTA scores: opt: 141, E(): 0.0041, (37.65% identity in 93 aa overlap); etc. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3581315 | 3581620 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3204|Rv3204
MAPVTDEQVELVRSLVAAIPLGRVSTYGDIAALTGLSSPRIVGWIMRTDSSDLPWHRVIRASGRPAQHLATRQLELLRAEGVLSVDGRVALSEIRYEFPPG
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
