Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCauses methylation
ProductPossible DNA-methyltransferase (modification methylase)
CommentsRv3204, (MTCY07D11.22c), len: 101 aa. Possible DNA methyltransferase, similar to many hypothetical bacteriel proteins and methyltransferases e.g. Q9KT40|VC1065 methylated-DNA--protein-cysteine methyltransferase-related protein from Vibrio cholerae (100 aa), FASTA scores: opt: 170, E(): 2.8e-05, (34.35% identity in 99 aa overlap); Q9UTN9|SPAC1250.04c putative methyltransferase from Schizosaccharomyces pombe (Fission yeast) (108 aa), FASTA scores: opt: 161, E(): 0.00013, (36.65% identity in 101 aa overlap); Q9YDF4|APE0959 175 AA long hypothetical methylated-DNA--protein-cysteine methyltransferase from Aeropyrum pernix (175 aa), FASTA scores: opt: 144, E(): 0.003, (37.95% identity in 87 aa overlap); Q50855 putative methylguanine-DNA methyltransferase from Myxococcus xanthus (147 aa), FASTA scores: opt: 141, E(): 0.0041, (37.65% identity in 93 aa overlap); etc.
Functional categoryInformation pathways
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35813153581620+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3204|Rv3204
MAPVTDEQVELVRSLVAAIPLGRVSTYGDIAALTGLSSPRIVGWIMRTDSSDLPWHRVIRASGRPAQHLATRQLELLRAEGVLSVDGRVALSEIRYEFPPG