Gene Rv3207c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3207c, (MTCY07D11.19), len: 285 aa. Conserved protein, highly similar but shorter (57 aa) to Q9CCG9|ML0816 hypothetical protein from Mycobacterium leprae (341 aa), FASTA scores: opt: 1676, E(): 9.7e-96, (81.0% identity in 284 aa overlap). Also similar to C-terminus of Q9FBI6|SCP8.36 hypothetical protein from Streptomyces coelicolor (559 aa), FASTA scores: opt: 426, E(): 8.4e-19, (37.35% identity in 281 aa overlap); and similar to other hypothetical proteins (generally membrane proteins) e.g. Q9K456|SC2H12.28C putative membrane protein from Streptomyces coelicolor (314 aa), FASTA scores: opt: 341, E(): 8.8e-14, (29.75% identity in 296 aa overlap). Contains neutral zinc metallopeptidases, zinc-binding region signature (PS00142). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3583801 | 3584658 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3207c|Rv3207c
VSTYGWRAYALPVLMVLTTVVVYQTVTGTSTPRPAAAQTVRDSPAIGVVGTAILDAPPRGLAVFDANLPAGTLPDGGPFTEAGDKTWRVVPGTTPQVGQGTVKVFRYTVEIENGLDPTMYGGDNAFAQMVDQTLTNPKGWTHNPQFAFVRIDSGKPDFRISLVSPTTVRGGCGYEFRLETSCYNPSFGGMDRQSRVFINEARWVRGAVPFEGDVGSYRQYVINHEVGHAIGYLRHEPCDQQGGLAPVMMQQTFSTSNDDAAKFDPDFVKADGKTCRFNPWPYPIP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant